PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA13485
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family TALE
Protein Properties Length: 401aa    MW: 45092.2 Da    PI: 6.61
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA13485genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-093253611955
                                HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                   Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                 +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Tp57577_TGAC_v2_mRNA13485 325 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 361
                                45679*****************************885 PP

2ELK40.94.1e-14281302122
                        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                ELK qLlrKYsgyLgsLkqEF+
  Tp57577_TGAC_v2_mRNA13485 281 ELKGQLLRKYSGYLGSLKQEFM 302
                                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.7E-19119163IPR005540KNOX1
PfamPF037906.7E-21120159IPR005540KNOX1
SMARTSM012565.4E-25170221IPR005541KNOX2
PfamPF037919.0E-21173220IPR005541KNOX2
SMARTSM011882.8E-8281302IPR005539ELK domain
PfamPF037896.8E-11281302IPR005539ELK domain
PROSITE profilePS5121311.174281301IPR005539ELK domain
PROSITE profilePS5007113.086301364IPR001356Homeobox domain
SuperFamilySSF466892.48E-19303379IPR009057Homeodomain-like
SMARTSM003891.2E-12303368IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.5E-28306366IPR009057Homeodomain-like
CDDcd000861.47E-12313365No hitNo description
PfamPF059207.5E-17321360IPR008422Homeobox KN domain
PROSITE patternPS000270339362IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MEGSSSNGNS SYHVMSAFGE NSGGLCSSMM MMPLVTSHQQ HHQHNHLLNS NNNPNNNNTN  60
ANNNSCHFLP IPNSTNNNNN NHYNMLQNNP NNNNTTTTTP GLGYYFMDNN NGSSSSSSSA  120
VKAKIMAHPH YHRLLEAYIN CQKVGAPGEV VARLEEACAS AVRMGGEGVG SGCIGEDPAL  180
DQFMEAYCEM LIKYEQELSK PLKEAMLFLQ RIEVQFKNLT VSSSSDNIDV FLFESKGSTQ  240
TLKALAGPEP ACNESGDRNG SSEEDHVDLY NMVDPQAEDR ELKGQLLRKY SGYLGSLKQE  300
FMKKRKKGKL PKEARQQLLE WWSRHYKWPY PSESQKLALA ESTGLDQKQI NNWFINQRKR  360
HWKPSEDMQF VVMDPTHPHY YMENNVLTNS YPMDLSNTML *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1296305LKQEFMKKRK
2302306KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0633071e-172AF063307.1 Pisum sativum Knox class 1 protein (Hop1) mRNA, complete cds.
GenBankAF0801041e-172AF080104.2 Pisum sativum knotted1-like class I homeodomain protein (PsKn1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462900.10.0homeobox knotted-like protein
SwissprotP466081e-162HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLO828050.0O82805_PEA; Knotted1-like class I homeodomain protein
STRINGGLYMA15G11850.11e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-122KNOX/ELK homeobox transcription factor